PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF034000040CFD_t1
Common NameTRAES_3BF034000040CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 335aa    MW: 35948.4 Da    PI: 5.3731
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF034000040CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.1e-171562148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT eEd ll  +++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  TRAES3BF034000040CFD_t1 15 RGPWTLEEDNLLMSYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYL 62
                             89********************************************97 PP

2Myb_DNA-binding50.93.6e-1668111146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T+eE++ ++++++++G++ W++Ia++++ gRt++++k++w++
  TRAES3BF034000040CFD_t1  68 RGNLTAEEQLVILELHAKWGNR-WSRIAQHLP-GRTDNEIKNYWRT 111
                              7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.791062IPR017930Myb domain
SuperFamilySSF466894.12E-3013109IPR009057Homeodomain-like
SMARTSM007172.2E-131464IPR001005SANT/Myb domain
PfamPF002497.9E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-231669IPR009057Homeodomain-like
CDDcd001676.93E-111762No hitNo description
PROSITE profilePS5129425.50363117IPR017930Myb domain
SMARTSM007171.8E-1467115IPR001005SANT/Myb domain
PfamPF002491.2E-1468111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2370116IPR009057Homeodomain-like
CDDcd001677.45E-1272111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MAMAAMEEEA AELRRGPWTL EEDNLLMSYI ACHGEGRWNL LARCSGLKRT GKSCRLRWLN  60
YLKPDIKRGN LTAEEQLVIL ELHAKWGNRW SRIAQHLPGR TDNEIKNYWR TRVQKQARQL  120
KVDANSAVFR DAVRCYWMPR LLDKMSMAAA STAAPPPLME QHGQGVLSSS QSPPIGSDQL  180
CCYGPAAAGF DPSPSASTSG STAAAALQPA PVPCFSELNW EDQYCYPSGG DLDGGAGGME  240
LDSAALLGSL GLDGLDLGPA ESYLPDATLL DYLNYSSCTA NAAMNMMAMN GGSYNNSSYC  300
GGGGAMVDGD HHDTTTAATT CHAARKLAGE WGGGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-28121161104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633684.11e-136PREDICTED: transcription factor MYB108 isoform X1
TrEMBLA0A077RU700.0A0A077RU70_WHEAT; Uncharacterized protein
STRINGMLOC_65555.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.14e-74myb domain protein 62
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]